Novel TranslatorNovel Translator
Pricing
Browse Library

Browse public novel info and discovery pages

Novel Rankings

Top novel lists by genre, language, and more

All Image Translators

Translate images you are allowed to use

Translation Guides

Genre-specific translation tips and vocabulary

Translation Glossary

SFX, honorifics, and comic translation terms

Suki Translate - iOS App

Translate images on your iPhone with our iOS app

EPUB Translation

Translate your EPUB files while keeping formatting

TXT Translation

Translate plain text files and drafts

NSFW Translation

Translate adult content with specialized handling

Chinese Novel Translation

Translate xianxia, wuxia, and cultivation novels

Japanese Novel Translation

Translate light novels, web novels, and isekai

Korean Novel Translation

Translate Korean web novels and manhwa

Traditional Chinese Translation

Translate Traditional Chinese novels

Manga Image Translator

Translate manga pages from Japanese, Korean, Chinese

Webtoon Translator

Translate Korean webtoons instantly

Manhwa Translator

Translate Korean manhwa pages and panels

Comic Image Translator

Translate text in comics and illustrated files

AI Manga Translator

Automatic AI-powered manga translation

Book Translation

Book translation for files you bring

MTL Translation

Clean up rough machine translation drafts

View All Applications

Browse all translation services

Free Ebook ReaderFree

Free desktop reader for manga, EPUB, and TXT novels

EPUB Split & Merge

Split large EPUBs or merge multiple files into one

Light Novel Title Generator

Generate hilariously long light novel titles

Technique Generator

Create unique martial arts and cultivation technique names

Realm Generator

Generate cultivation realm titles for Xianxia stories

Xianxia Profile Generator

Create your own Xianxia Profile Picture and Backstory

Plot Generator

Generate compelling story frameworks and plot summaries

Backstory Generator

Generate rich character backgrounds and motivations

Novel File Cleaner

Clean EPUB/TXT files and validate EPUB structure

Name Generator

Generate culturally appropriate Asian fantasy names

LN Release Calendar

Track upcoming Japanese light novel releases

Reading Time Calculator

Calculate reading time for light novels and web novels

Quote Generator

Create epic quotes and humorous character dialogues

Pinyin Converter

Convert Chinese and Korean text to romanization

Trope Generator

Generate random web novel trope combinations for inspiration

Paragraph Line Splitter

Split text into clean paragraphs with customizable rules

Terminology Database

Searchable database of Wuxia, Xianxia, and Murim terms

CJK Text Formatter

Convert vertical CJK text to horizontal format

Bulk Find & Replace

Search and replace text across EPUB and TXT files

PDF to TXT Converter

Convert PDF documents to plain text format

Manga & Comic Glossary

Sound effects, honorifics, and translation terms explained

Novel TranslatorNovel Translator
  1. Library
  2. We Will Never Get Back Together: A Second Chance Romance
We Will Never Get Back Together: A Second Chance Romance

We Will Never Get Back Together: A Second Chance Romance

WE DO NOT HOST CHAPTERS, DOWNLOADS, SCANS, OR SOURCE FILES FOR THIS TITLE.

This page is for book information only. Upload a file only if you own it, created it, licensed it, or have permission to translate it.

不妻而遇:第一大牌弃妇!

Original Chinese Title

Also known as: 不妻而遇:第一大牌弃妇!

By 超灵的佑子

2.2
Translate your file

Use your own, licensed, public-domain, or permissioned copy.

CompletedchineseWeb Novel
Language
chinese
Type
Web Novel
Status
Completed
Chapters
473 chapters
Original Publisher
anysoft

Genres

Browse Library →
adultdramajoseimatureromancetragedy
Chapters

473 chapters

Started

2018

Description

“A five-year marriage: she is alone during the registration of the marriage and so was she during the pregnancy in October. She got such serious throes of pre-production that she passed out several times. After she woke up, still alone. The first words Zhan Xunjue said to her were:” She’s come back, we shall divorce now.”

Tags

Click any tag to find similar novels in the library

abusive charactersaffaircheatsdivorcedoctorsfemale protagonistforced marriagehospitallate romancelove trianglesmarriagempregpregnancyweak protagonist

Discovery

chinese novelsadult novels

Popular chinese titles

Chusan’s Liuyi Children’s DayChasing JadeYesterdayTransmigration: A Plan to Save My Lovely Wife and Adorable ChildI Asked You To Simulate A Crime, And You Pulled Off The Perfect Crime?After the Empress Divorced Me, I Got a Hundred-Millionfold Cultivation Boost

Publication Information

Original Publisher
anysoft
Original Language
chinese
Type
Web Novel

We Will Never Get Back Together: A Second Chance Romance Review & Spoilers - Novel Translator

My Thoughts on We Will Never Get Back Together: A Second Chance Romance

"We Will Never Get Back Together: A Second Chance Romance" is... well, it's certainly a ride. A bumpy, emotionally draining ride. I went into this expecting a story of reconciliation and healing, but what I found was a tangled web of questionable choices and frustrating character dynamics.

First Impressions

Right off the bat, the premise intrigued me. A second chance romance is always a gamble, and the title suggested a healthy dose of drama. However, almost immediately I was thrown into a situation that felt more toxic than romantic. The initial chapters paint a picture of a marriage devoid of affection, with a male lead who seems completely oblivious to the female lead's existence, let alone her feelings.

What Works Well

Honestly, finding elements to praise was a challenge. The author creates a palpable sense of tension and emotional turmoil. I will admit, there are moments where the female lead's resilience shines through. Her dedication to her child is admirable, and there are glimpses of strength beneath her seemingly submissive exterior. The brief periods of "slow mute romance" during the male lead's treatment after a landslide were a breath of fresh air, offering a brief respite from the overall angst.

Areas of Concern

My biggest issue lies with the male lead. His behavior is, frankly, appalling. He's dismissive, inconsiderate, and at times, downright cruel. It's difficult to understand why the female lead would even consider a reconciliation, given the depth of his past transgressions. The power imbalance in their relationship is also deeply unsettling. It's hard to root for a couple when one half consistently bulldozes over the other's feelings and desires. I also found the female lead's decisions to be questionable at times, particularly her willingness to endure mistreatment.

⚠️ Spoiler Warning

Click "Reveal" to show spoiler content

Final Verdict

Ultimately, "We Will Never Get Back Together: A Second Chance Romance" is a difficult read. While it explores themes of forgiveness and redemption, the execution falls short. The problematic character dynamics and questionable plot choices left me feeling more frustrated than satisfied. If you're looking for a lighthearted romance, steer clear. But if you're drawn to stories with morally grey characters and a high tolerance for angst, this might be worth a try – proceed with caution.

Featured On

Top 11 Trending Adult Novels of 2026Top 11 Trending Drama Novels of 2026Top 17 Most Popular Drama Novels

Image Translation Guides

Chinese to English Manhua Translator

Translate Chinese manhua to English. Handles hanzi OCR, chengyu idioms, cultivation terminology, and Simplified/Traditional character detection. Use images you have permission to work with.

ChineseEnglishmanhua

Chinese to Spanish Manhua Translator

Translate Chinese manhua to Spanish with hanzi OCR. Handles xianxia cultivation terms, historical honorifics, and Traditional/Simplified Chinese. Use images you have permission to work with.

ChineseSpanishmanhua

Chinese to French Manhua Translator

Translate Chinese manhua to French with hanzi OCR. Handles four-character idioms, measure words, cultivation terms, and gendered French grammar. Use images you have permission to work with.

ChineseFrenchmanhua

Alchemy Manhua Translation Guide: Mastering the Elixirs & Cultivation

Unravel the complexities of Alchemy manhua translation with our comprehensive guide. Explore unique challenges, essential terms, and practical tips for

manhuaalchemy

Martial Arts Wuxia Manhua Translation Guide

Unravel the secrets of translating Wuxia manhua with this comprehensive guide, covering unique challenges, essential Chinese martial arts terms, and

manhuamartial-arts-wuxia

Chinese Manhua Action Sound Effects (SFX) Glossary

Explore 28 essential Chinese action sound effects (SFX) commonly found in manhua. This glossary helps readers and translators understand common battle

Chineseaction-sfx

Related Novels

A Good Girl and Her Protective Billionaire HusbandCompleted

A Good Girl and Her Protective Billionaire Husband

东二爷

2.7
actionadultdrama

Description coming soon.

Love after Marriage: No Escape from My Billionaire HusbandCompleted

Love after Marriage: No Escape from My Billionaire Husband

乌龟鹿

2.7
actionadultdrama

Description coming soon.

Unveiling Her Innocence: Drive Me WildCompleted

Unveiling Her Innocence: Drive Me Wild

fee yip, 叶菲

2.9
adultdramajosei

Description coming soon.

Riding The BossCompleted

Riding The Boss

miss lau, 刘大小姐

2.7
adultcomedydrama

Description coming soon.

Resources

  • Features
  • Showcases
  • Pricing
  • Pricing Calculator
  • Novel Tools
  • Blog
  • Library
  • Novel Rankings
  • Image Translators
  • Translation Glossary
  • Contact Us

Friends

  • Webnovels AI
  • Lightnovels AI
  • Datingprofiles AI
  • KQM
  • KQM HSR
  • Kensaku AI - Programmatic SEO

FREE Tools

  • EPUB Split & Merge
  • Light Novel Title Generator
  • Technique Generator
  • Realm Generator
  • Xianxia Profile Generator
  • Plot Generator

Applications

  • Manga Image Translator
  • Webtoon Translator
  • Manhwa Translator
  • EPUB Translation
  • Chinese Novel Translation
  • Japanese Novel Translation

Novel TranslatorNovel Translator

Private AI translation for documents, EPUBs, TXT files, images, and manuscripts you own or have permission to use.

© 2026 • Novel Translator. All rights reserved.

  • Privacy Policy
  • Terms of Service
  • Copyright / DMCA
  • Responsible Use