Novel TranslatorNovel Translator
Pricing
Browse Library

Browse public novel info and discovery pages

Novel Rankings

Top novel lists by genre, language, and more

All Image Translators

Translate images you are allowed to use

Translation Guides

Genre-specific translation tips and vocabulary

Translation Glossary

SFX, honorifics, and comic translation terms

Suki Translate - iOS App

Translate images on your iPhone with our iOS app

EPUB Translation

Translate your EPUB files while keeping formatting

TXT Translation

Translate plain text files and drafts

NSFW Translation

Translate adult content with specialized handling

Chinese Novel Translation

Translate xianxia, wuxia, and cultivation novels

Japanese Novel Translation

Translate light novels, web novels, and isekai

Korean Novel Translation

Translate Korean web novels and manhwa

Traditional Chinese Translation

Translate Traditional Chinese novels

Manga Image Translator

Translate manga pages from Japanese, Korean, Chinese

Webtoon Translator

Translate Korean webtoons instantly

Manhwa Translator

Translate Korean manhwa pages and panels

Comic Image Translator

Translate text in comics and illustrated files

AI Manga Translator

Automatic AI-powered manga translation

Book Translation

Book translation for files you bring

MTL Translation

Clean up rough machine translation drafts

View All Applications

Browse all translation services

Free Ebook ReaderFree

Free desktop reader for manga, EPUB, and TXT novels

EPUB Split & Merge

Split large EPUBs or merge multiple files into one

Light Novel Title Generator

Generate hilariously long light novel titles

Technique Generator

Create unique martial arts and cultivation technique names

Realm Generator

Generate cultivation realm titles for Xianxia stories

Xianxia Profile Generator

Create your own Xianxia Profile Picture and Backstory

Plot Generator

Generate compelling story frameworks and plot summaries

Backstory Generator

Generate rich character backgrounds and motivations

Novel File Cleaner

Clean EPUB/TXT files and validate EPUB structure

Name Generator

Generate culturally appropriate Asian fantasy names

LN Release Calendar

Track upcoming Japanese light novel releases

Reading Time Calculator

Calculate reading time for light novels and web novels

Quote Generator

Create epic quotes and humorous character dialogues

Pinyin Converter

Convert Chinese and Korean text to romanization

Trope Generator

Generate random web novel trope combinations for inspiration

Paragraph Line Splitter

Split text into clean paragraphs with customizable rules

Terminology Database

Searchable database of Wuxia, Xianxia, and Murim terms

CJK Text Formatter

Convert vertical CJK text to horizontal format

Bulk Find & Replace

Search and replace text across EPUB and TXT files

PDF to TXT Converter

Convert PDF documents to plain text format

Manga & Comic Glossary

Sound effects, honorifics, and translation terms explained

Novel TranslatorNovel Translator
  1. Library
  2. Sign In: Becoming A Great Spell Deity Starting From The Magic Academy
Sign In: Becoming A Great Spell Deity Starting From The Magic Academy

Sign In: Becoming A Great Spell Deity Starting From The Magic Academy

WE DO NOT HOST CHAPTERS, DOWNLOADS, SCANS, OR SOURCE FILES FOR THIS TITLE.

This page is for book information only. Upload a file only if you own it, created it, licensed it, or have permission to translate it.

签到:从魔法学院开始做大法神

Original Chinese Title

Also known as: 签到:从魔法学院开始做大法神

By dr.boom

2.2
Translate your file

Use your own, licensed, public-domain, or permissioned copy.

CompletedPublisher info listedchineseWeb Novel
Language
chinese
Type
Web Novel
Status
Completed
Chapters
540 chapters
Original Publisher
qidian
English Publisher
webnovel

Genres

Browse Library →
actionadultfantasyharemmature
Chapters

540 chapters

Started

Description

“Crossing over to a fantasy world of magic and battle auras, Lei Luo accidentally crossed over to the Xiluo Magic Academy and became a librarian. At the same time, he obtained a Sign-in System. He would receive various rewards if he signed in at different locations. Signed in at the library and obtained [Top-grade Meditation Technique] from the treasure chest! Signed in on the Magic Guide Book and obtained [Magic Increase] from the treasure chest! Signed in on the Magic Stone Tablet and obtained [Forbidden Magic] from the treasure chest! … Lei Luo unintentionally activated something that would completely turn his life around He started signing in from the Magic Academy and slowly advanced from a Magic Apprentice to become the most powerful person in the Magic Academy. He led the Magic Knights that shocked the world to eliminate noble factions and fight against the invasion of the demon tribe. Changing the world began with him. From a desolate small town to the lord of the world, he reignited the glory of an empire that had been down and out for a century.”

Tags

Click any tag to find similar novels in the library

calm protagonistcheatsdwarfselvesempiresfast cultivationhidden abilitieslow key protagonistmagicmale protagonistnaive protagonistoverpowered protagonistsecret identitys*xual cultivation techniquesystem administratorweak to strong

Discovery

chinese novelsadult novels

Popular chinese titles

Chusan’s Liuyi Children’s DayChasing JadeYesterdayTransmigration: A Plan to Save My Lovely Wife and Adorable ChildI Asked You To Simulate A Crime, And You Pulled Off The Perfect Crime?After the Empress Divorced Me, I Got a Hundred-Millionfold Cultivation Boost

Publication Information

Original Publisher
qidian
English Publisher
webnovel
Original Language
chinese
Type
Web Novel

Sign In: Becoming A Great Spell Deity Starting From The Magic Academy Review & Spoilers - Novel Translator

My Thoughts on Sign In: Becoming A Great Spell Deity Starting From The Magic Academy

Alright, let's dive into "Sign In: Becoming A Great Spell Deity Starting From The Magic Academy." I went in with moderate expectations, intrigued by the premise of a calm, low-key protagonist steadily becoming overpowered through a sign-in system. However, my journey through this novel was... complicated.

First Impressions

Initially, I was drawn in by the "hidden OP MC" trope and the promise of a tranquil, library-focused existence. The early chapters painted a picture of a protagonist content with quietly cultivating his power, occasionally lending a hand to the kingdom out of a sense of obligation to his friends. This setup had potential, reminding me a bit of "Top Tier Providence" but with a faster cultivation pace.

What Works Well

The initial concept of a protagonist who prioritizes personal growth and avoids unnecessary conflict is appealing. Some readers appreciated the early chapters where the MC maintains a low profile while steadily becoming stronger. The idea of a "monk type" character, content with a simple life but capable of immense power, resonated with some. There was a general consensus that the first 244 chapters were fun. Also the R18 scenes somehow managed to escape censorship.

Areas of Concern

Unfortunately, the novel seems to take a sharp turn around chapter 245, and that's where things started to fall apart for me. Several readers expressed disappointment with the drastic shift in plot and character development. The MC seemingly transforms into a completely different person, and the original world and characters are largely forgotten. The introduction of a new world and a harem with questionable dynamics raised serious red flags. The later part of the novel is also said to be disjointed and doesn't spend enough time building the world setting. One of the biggest issues is the inconsistency in the MC's actions. His motivations and choices often seem random, making it difficult to connect with him or understand his goals.

⚠️ Spoiler Warning

Click "Reveal" to show spoiler content

Final Verdict

Ultimately, "Sign In: Becoming A Great Spell Deity Starting From The Magic Academy" is a deeply flawed novel. While the initial premise and the first portion of the story hold some appeal, the drastic shift in plot, inconsistent character development, and potentially problematic themes make it difficult to recommend. The novel feels disjointed and directionless, with a confusing plot and a protagonist who is hard to root for. Proceed with caution, and be prepared for a potentially disappointing experience.

Featured On

Top 11 Trending Adult Novels of 2026Top 11 Trending Fantasy Novels of 2026Top 11 Trending Harem Novels of 2026

Image Translation Guides

Chinese to English Manhua Translator

Translate Chinese manhua to English. Handles hanzi OCR, chengyu idioms, cultivation terminology, and Simplified/Traditional character detection. Use images you have permission to work with.

ChineseEnglishmanhua

Chinese to Spanish Manhua Translator

Translate Chinese manhua to Spanish with hanzi OCR. Handles xianxia cultivation terms, historical honorifics, and Traditional/Simplified Chinese. Use images you have permission to work with.

ChineseSpanishmanhua

Chinese to French Manhua Translator

Translate Chinese manhua to French with hanzi OCR. Handles four-character idioms, measure words, cultivation terms, and gendered French grammar. Use images you have permission to work with.

ChineseFrenchmanhua

Alchemy Manhua Translation Guide: Mastering the Elixirs & Cultivation

Unravel the complexities of Alchemy manhua translation with our comprehensive guide. Explore unique challenges, essential terms, and practical tips for

manhuaalchemy

Martial Arts Wuxia Manhua Translation Guide

Unravel the secrets of translating Wuxia manhua with this comprehensive guide, covering unique challenges, essential Chinese martial arts terms, and

manhuamartial-arts-wuxia

Chinese Manhua Action Sound Effects (SFX) Glossary

Explore 28 essential Chinese action sound effects (SFX) commonly found in manhua. This glossary helps readers and translators understand common battle

Chineseaction-sfx

Related Novels

Sign-in Buddha’s Palm

Sign-in Buddha’s Palm

back to the beginning, 回到原初

3.7
actionadventuremartial arts

Description coming soon.

Resources

  • Features
  • Showcases
  • Pricing
  • Pricing Calculator
  • Novel Tools
  • Blog
  • Library
  • Novel Rankings
  • Image Translators
  • Translation Glossary
  • Contact Us

Friends

  • Webnovels AI
  • Lightnovels AI
  • Datingprofiles AI
  • KQM
  • KQM HSR
  • Kensaku AI - Programmatic SEO

FREE Tools

  • EPUB Split & Merge
  • Light Novel Title Generator
  • Technique Generator
  • Realm Generator
  • Xianxia Profile Generator
  • Plot Generator

Applications

  • Manga Image Translator
  • Webtoon Translator
  • Manhwa Translator
  • EPUB Translation
  • Chinese Novel Translation
  • Japanese Novel Translation

Novel TranslatorNovel Translator

Private AI translation for documents, EPUBs, TXT files, images, and manuscripts you own or have permission to use.

© 2026 • Novel Translator. All rights reserved.

  • Privacy Policy
  • Terms of Service
  • Copyright / DMCA
  • Responsible Use