Novel TranslatorNovel Translator
Pricing
Browse Library

Browse public novel info and discovery pages

Novel Rankings

Top novel lists by genre, language, and more

All Image Translators

Translate images you are allowed to use

Translation Guides

Genre-specific translation tips and vocabulary

Translation Glossary

SFX, honorifics, and comic translation terms

Suki Translate - iOS App

Translate images on your iPhone with our iOS app

EPUB Translation

Translate your EPUB files while keeping formatting

TXT Translation

Translate plain text files and drafts

NSFW Translation

Translate adult content with specialized handling

Chinese Novel Translation

Translate xianxia, wuxia, and cultivation novels

Japanese Novel Translation

Translate light novels, web novels, and isekai

Korean Novel Translation

Translate Korean web novels and manhwa

Traditional Chinese Translation

Translate Traditional Chinese novels

Manga Image Translator

Translate manga pages from Japanese, Korean, Chinese

Webtoon Translator

Translate Korean webtoons instantly

Manhwa Translator

Translate Korean manhwa pages and panels

Comic Image Translator

Translate text in comics and illustrated files

AI Manga Translator

Automatic AI-powered manga translation

Book Translation

Book translation for files you bring

MTL Translation

Clean up rough machine translation drafts

View All Applications

Browse all translation services

Free Ebook ReaderFree

Free desktop reader for manga, EPUB, and TXT novels

EPUB Split & Merge

Split large EPUBs or merge multiple files into one

Light Novel Title Generator

Generate hilariously long light novel titles

Technique Generator

Create unique martial arts and cultivation technique names

Realm Generator

Generate cultivation realm titles for Xianxia stories

Xianxia Profile Generator

Create your own Xianxia Profile Picture and Backstory

Plot Generator

Generate compelling story frameworks and plot summaries

Backstory Generator

Generate rich character backgrounds and motivations

Novel File Cleaner

Clean EPUB/TXT files and validate EPUB structure

Name Generator

Generate culturally appropriate Asian fantasy names

LN Release Calendar

Track upcoming Japanese light novel releases

Reading Time Calculator

Calculate reading time for light novels and web novels

Quote Generator

Create epic quotes and humorous character dialogues

Pinyin Converter

Convert Chinese and Korean text to romanization

Trope Generator

Generate random web novel trope combinations for inspiration

Paragraph Line Splitter

Split text into clean paragraphs with customizable rules

Terminology Database

Searchable database of Wuxia, Xianxia, and Murim terms

CJK Text Formatter

Convert vertical CJK text to horizontal format

Bulk Find & Replace

Search and replace text across EPUB and TXT files

PDF to TXT Converter

Convert PDF documents to plain text format

Manga & Comic Glossary

Sound effects, honorifics, and translation terms explained

Novel TranslatorNovel Translator
  1. Library
  2. Future Knight
Future Knight

Future Knight

WE DO NOT HOST CHAPTERS, DOWNLOADS, SCANS, OR SOURCE FILES FOR THIS TITLE.

This page is for book information only. Upload a file only if you own it, created it, licensed it, or have permission to translate it.

퓨쳐나이트

Original Korean Title

Also known as: 퓨쳐나이트

By 영웅객사

2.7
Translate your file

Use your own, licensed, public-domain, or permissioned copy.

CompletedkoreanWeb Novel
Language
korean
Type
Web Novel
Status
Completed
Chapters
150 chapters
Original Publisher
kakaopage

Genres

Browse Library →
actionadventuredramafantasymaturesci-fisupernatural
Chapters

150 chapters

Started

2023

Description

Code Number UNA-102A, Serial Number 5425582, Captain Kang Chan Awakens in a New World 『Future Knight』 Kang Chan, a future human from Earth, crash-lands due to a sudden accident. All his comrades are dead, and he alone survives. “Where on earth am I?” Before his eyes lay an utterly bizarre landscape and incomprehensible beings from another world. “I will survive and complete my mission at all costs.” To complete his mission, he must first survive in this place. Combining future technology and the swordsmanship of another world, Kang Chan’s journey of survival as he evolves into a new kind of knight unfolds!

Tags

Click any tag to find similar novels in the library

aliensdwarfselvesempiresfantasy creaturesfantasy worldhot blooded protagonisthuman weaponlanguage barriermagicmale protagonistmodern knowledgenear death experienceorcspast traumaprotagonist strong from the startromantic subplotsoldierssword and magicsword wieldertechnological gaptime skipwars

Publication Information

Original Publisher
kakaopage
Original Language
korean
Type
Web Novel

Future Knight Review & Spoilers - Novel Translator

My Thoughts on Future Knight

"Future Knight" presents an intriguing blend of sci-fi and fantasy, a concept that immediately grabbed my attention. The premise of a futuristic soldier finding himself in a medieval-esque world is ripe with potential, and I went in eager to see how the author would navigate this clash of civilizations.

First Impressions

Initially, I was hooked. The setup is well-executed, and the mystery surrounding the MC's arrival in this new world is compelling. The early chapters effectively foreshadow the ripple effects his presence will have. I appreciated the story's commitment to showing both the strengths of the futuristic tech and the value of the fantasy world's magic and knowledge.

What Works Well

The action sequences are definitely a strong point. The war plotline kept me engaged even when other aspects of the story faltered. The world-building, in terms of the political landscape and the integration of fantasy creatures, is also commendable. The author avoids the common pitfall of making the protagonist instantly overpowered or turning the fantasy world into a primitive backdrop. Instead, there's a sense of mutual respect and recognition of value between the two worlds.

Areas of Concern

However, as I progressed, I started to notice some cracks in the foundation. My biggest issue lies with the main character. Despite his supposedly traumatic past and upbringing as a "human weapon," his personality feels surprisingly generic. He often comes across as a typical shounen protagonist, which diminishes the impact of his backstory. I found myself wanting more depth and complexity, more evidence of how his past shapes his present actions and decisions. His emotional reactions also felt inconsistent. The story tells us he should be affected by certain events, but his behavior often contradicts this. This lack of consistent characterization ultimately made it difficult for me to fully invest in his journey. The pacing also started to drag after the initial excitement wore off, leading to a sense of boredom.

Final Verdict

"Future Knight" has a lot of promise, and the core concept is undeniably appealing. While the action and world-building are solid, the lackluster characterization and inconsistent pacing ultimately hold it back. If you're a fan of action-heavy fantasy with a sci-fi twist and aren't overly concerned with character depth, you might find this enjoyable. However, if you prioritize character-driven narratives, you may be left wanting more. For me, it lands as a somewhat interesting read with some flaws.

Featured On

Top 11 Trending Drama Novels of 2026Top 11 Trending Fantasy Novels of 2026Top 17 Most Popular Action Novels

Image Translation Guides

Korean to English Manhwa Translator

Translate Korean manhwa and webtoons to English. Handles Hangul OCR, honorific systems, Korean SFX, and vertical scroll webtoon formats. Use images you have permission to work with.

KoreanEnglishmanhwa

Korean to Spanish Manhwa Translator

Translate Korean manhwa and webtoons to Spanish with accurate Hangul OCR, honorific handling, and SFX translation. Use only images you have permission to work with.

KoreanSpanishmanhwa

Korean to Portuguese Manhwa Translator

Translate Korean manhwa to Portuguese with accurate handling of honorifics, SFX, and colloquial dialogue. Use only images you have permission to work with.

KoreanPortuguesemanhwa

Horror Thriller Manhwa Translation Guide

Dive into the chilling world of Horror Thriller manhwa with our comprehensive translation guide. Learn about unique challenges, essential Korean terms,

manhwahorror-thriller

Hunter Gates Manhwa Translation Guide

Dive into the world of Hunter Gates manhwa translation. This guide covers unique challenges, essential Korean genre terms, and practical tips for

manhwahunter-gates

Korean Manhwa Action Sound Effects (SFX) Glossary

Explore 28 essential Korean action sound effects (SFX) commonly found in manhwa and webtoons. This glossary helps readers and translators understand

Koreanaction-sfx

Resources

  • Features
  • Showcases
  • Pricing
  • Pricing Calculator
  • Novel Tools
  • Blog
  • Library
  • Novel Rankings
  • Image Translators
  • Translation Glossary
  • Contact Us

Friends

  • Webnovels AI
  • Lightnovels AI
  • Datingprofiles AI
  • KQM
  • KQM HSR
  • Kensaku AI - Programmatic SEO

FREE Tools

  • EPUB Split & Merge
  • Light Novel Title Generator
  • Technique Generator
  • Realm Generator
  • Xianxia Profile Generator
  • Plot Generator

Applications

  • Manga Image Translator
  • Webtoon Translator
  • Manhwa Translator
  • EPUB Translation
  • Chinese Novel Translation
  • Japanese Novel Translation

Novel TranslatorNovel Translator

Private AI translation for documents, EPUBs, TXT files, images, and manuscripts you own or have permission to use.

© 2026 • Novel Translator. All rights reserved.

  • Privacy Policy
  • Terms of Service
  • Copyright / DMCA
  • Responsible Use