Novel TranslatorNovel Translator
Pricing
Browse Library

Browse public novel info and discovery pages

Novel Rankings

Top novel lists by genre, language, and more

All Image Translators

Translate images you are allowed to use

Translation Guides

Genre-specific translation tips and vocabulary

Translation Glossary

SFX, honorifics, and comic translation terms

Suki Translate - iOS App

Translate images on your iPhone with our iOS app

EPUB Translation

Translate your EPUB files while keeping formatting

TXT Translation

Translate plain text files and drafts

NSFW Translation

Translate adult content with specialized handling

Chinese Novel Translation

Translate xianxia, wuxia, and cultivation novels

Japanese Novel Translation

Translate light novels, web novels, and isekai

Korean Novel Translation

Translate Korean web novels and manhwa

Traditional Chinese Translation

Translate Traditional Chinese novels

Manga Image Translator

Translate manga pages from Japanese, Korean, Chinese

Webtoon Translator

Translate Korean webtoons instantly

Manhwa Translator

Translate Korean manhwa pages and panels

Comic Image Translator

Translate text in comics and illustrated files

AI Manga Translator

Automatic AI-powered manga translation

Book Translation

Book translation for files you bring

MTL Translation

Clean up rough machine translation drafts

View All Applications

Browse all translation services

Free Ebook ReaderFree

Free desktop reader for manga, EPUB, and TXT novels

EPUB Split & Merge

Split large EPUBs or merge multiple files into one

Light Novel Title Generator

Generate hilariously long light novel titles

Technique Generator

Create unique martial arts and cultivation technique names

Realm Generator

Generate cultivation realm titles for Xianxia stories

Xianxia Profile Generator

Create your own Xianxia Profile Picture and Backstory

Plot Generator

Generate compelling story frameworks and plot summaries

Backstory Generator

Generate rich character backgrounds and motivations

Novel File Cleaner

Clean EPUB/TXT files and validate EPUB structure

Name Generator

Generate culturally appropriate Asian fantasy names

LN Release Calendar

Track upcoming Japanese light novel releases

Reading Time Calculator

Calculate reading time for light novels and web novels

Quote Generator

Create epic quotes and humorous character dialogues

Pinyin Converter

Convert Chinese and Korean text to romanization

Trope Generator

Generate random web novel trope combinations for inspiration

Paragraph Line Splitter

Split text into clean paragraphs with customizable rules

Terminology Database

Searchable database of Wuxia, Xianxia, and Murim terms

CJK Text Formatter

Convert vertical CJK text to horizontal format

Bulk Find & Replace

Search and replace text across EPUB and TXT files

PDF to TXT Converter

Convert PDF documents to plain text format

Manga & Comic Glossary

Sound effects, honorifics, and translation terms explained

Novel TranslatorNovel Translator
  1. Library
  2. The Baby Isn’t Yours
The Baby Isn’t Yours

The Baby Isn’t Yours

WE DO NOT HOST CHAPTERS, DOWNLOADS, SCANS, OR SOURCE FILES FOR THIS TITLE.

This page is for book information only. Upload a file only if you own it, created it, licensed it, or have permission to translate it.

너의 아이가 아니야

Original Korean Title

Also known as: It's Not Your Baby (Official Manhwa), TBIY, 너의 아이가 아니야

By arongdri, 아롱드리

4.0
Translate your file

Use your own, licensed, public-domain, or permissioned copy.

CompletedkoreanWeb Novel
Language
korean
Type
Web Novel
Status
Completed
Chapters
192 chapters
Original Publisher
kakaopage

Genres

Browse Library →
comedydramafantasyromanceslice of life
Chapters

192 chapters

Started

2019

Description

“This baby isn’t yours.” Simon’s eyes glistened coldly at my words. Apparently he’s smiling, but in a strange and spine-chilling tone, Simon asked me. “…Oh, really?” That low, shady voice, pretending to be gentle. The anger in his voice was cold and cruel enough to freeze his surroundings. “Then, which bastard does that child belong to?” He’s angry. I’ve known him for a long time that’s why I could tell. That’s the voice that comes out when he can no longer hold back his anger. But then… why the hell is he so upset? “If you know, what are you going to do?” “That jerk can’t even be a good father so…” “…… so what?” “I can’t let him live.” Oh no. I’m in trouble. After seeing his golden eyes lit with fire, there’s no way I could tell him now that it’s his child. *** Kalia, the great war hero who ended the war. One day finds out that she’s… pregnant?! Of all people, the father of her baby, the one she spent the passionate night with, is Simon Terroan, an imperial sorcerer and her best friend. Kalia believes that Simon doesn’t want a baby, so while Simon is away, she declares her retirement and vanishes to hide the truth about her pregnancy and to safely give birth to her baby. But the truth is, Simon loved Kalia more than anyone else. And so, the frantic search for her begins.

Tags

Click any tag to find similar novels in the library

adapted to manhwabeautiful female leadchildcarechildhood friendschildhood loveclingy lovercouple growthcruel characterscute childrendemi humansdemonsdense protagonistdetermined protagonistdevoted love interestsdifferent social statusdoting love interestselemental magicelvesempiresfairiesfamilyfamous protagonistfantasy creaturesfantasy worldfemale protagonistfirst lovegeneralshalf human protagonisthandsome male leadheroeshidden abilitieshiding true identityhonest protagonisthuman experimentationkingdomsknightslove interest falls in love firstmagicmale yanderemanipulative charactersmisunderstandingsmonstersmysterious family backgroundmysterious pastnoblesorphansoverpowered protagonistpast plays a big rolepersistent love interestspopular love interestspossessive characterspower couplepregnancyprotagonist strong from the startpsychopathsroyaltysecret crushsoulsspiritsstrong love interestssword and magicunique weaponswarswizards

Publication Information

Original Publisher
kakaopage
Original Language
korean
Type
Web Novel

The Baby Isn’t Yours Review & Spoilers - Novel Translator

My Thoughts on The Baby Isn’t Yours

"The Baby Isn’t Yours" definitely took me on a rollercoaster of emotions! With a solid 4-star rating overall, I was eager to jump in, and I found myself both charmed and slightly frustrated at different points. This novel blends comedy, drama, fantasy, romance, and slice of life, which makes for a unique reading experience, but also leads to some unevenness.

First Impressions

The premise itself is intriguing: a strong female knight, a mage best friend, a secret pregnancy, and a dash of fantasy. I immediately appreciated the strong female lead, a former orphan turned war general. Her desire for a family resonated with me, and I was invested in her journey from the start. The comedic misunderstandings were genuinely funny, especially the night of the baby's conception.

What Works Well

The humor is definitely a strong point. I found myself laughing out loud at the absurd situations and the characters' interactions. The male lead's devotion to the female lead is also endearing, and I could easily root for their romance. The world-building, while not the most intricate, provides a solid backdrop for the story. I appreciate how the story explores the development of both protagonists as individuals and as a couple, especially as they navigate the challenges of parenthood.

Areas of Concern

However, I did find some aspects of the story less compelling. The female lead's density regarding the male lead's feelings can be frustrating. While some found the world building confusing, I found it rather simple. Also, the male lead's characterization is too defined by his love for the female lead, and that more of his personality could have been explored.

⚠️ Spoiler Warning

Click "Reveal" to show spoiler content

Final Verdict

Overall, "The Baby Isn’t Yours" is an enjoyable read with a good balance of humor, romance, and fantasy. While it has its flaws, the engaging plot, the strong female lead, and the comedic misunderstandings make it worth checking out. If you're looking for a lighthearted story with a touch of angst and a lot of heart, this novel might be right up your alley.

Featured On

Top 11 Korean Fantasy Adventure NovelsTop 11 Korean Romance Comedy NovelsTop 11 Korean Romance Drama Novels

Image Translation Guides

Korean to English Manhwa Translator

Translate Korean manhwa and webtoons to English. Handles Hangul OCR, honorific systems, Korean SFX, and vertical scroll webtoon formats. Use images you have permission to work with.

KoreanEnglishmanhwa

Korean to Spanish Manhwa Translator

Translate Korean manhwa and webtoons to Spanish with accurate Hangul OCR, honorific handling, and SFX translation. Use only images you have permission to work with.

KoreanSpanishmanhwa

Korean to Portuguese Manhwa Translator

Translate Korean manhwa to Portuguese with accurate handling of honorifics, SFX, and colloquial dialogue. Use only images you have permission to work with.

KoreanPortuguesemanhwa

Horror Thriller Manhwa Translation Guide

Dive into the chilling world of Horror Thriller manhwa with our comprehensive translation guide. Learn about unique challenges, essential Korean terms,

manhwahorror-thriller

Hunter Gates Manhwa Translation Guide

Dive into the world of Hunter Gates manhwa translation. This guide covers unique challenges, essential Korean genre terms, and practical tips for

manhwahunter-gates

Korean Manhwa Action Sound Effects (SFX) Glossary

Explore 28 essential Korean action sound effects (SFX) commonly found in manhwa and webtoons. This glossary helps readers and translators understand

Koreanaction-sfx

Related Novels

I Don’t Want to Be LovedCompleted

I Don’t Want to Be Loved

starlight

3.9
adultdramafantasy

Description coming soon.

I Raised A Black DragonCompleted

I Raised A Black Dragon

dalseul, 달슬

4.2
actioncomedyfantasy

Description coming soon.

The Mistress Runs AwayCompleted

The Mistress Runs Away

baek seol eun, 백설은

2.7
adultdramafantasy

Description coming soon.

A Transmigrator’s PrivilegeCompleted

A Transmigrator’s Privilege

lee rinbi, 이린비

4.6
actioncomedydrama

Description coming soon.

You Two Will Give Birth To Me In The FutureCompleted

You Two Will Give Birth To Me In The Future

rakki, 롹끼

3.4
dramafantasyromance

Description coming soon.

How The Sub-Male Lead’s Stepmother Teaches LoveCompleted

How The Sub-Male Lead’s Stepmother Teaches Love

bam-eundal, 밤은달

4.1
comedydramafantasy

Description coming soon.

Resources

  • Features
  • Showcases
  • Pricing
  • Pricing Calculator
  • Novel Tools
  • Blog
  • Library
  • Novel Rankings
  • Image Translators
  • Translation Glossary
  • Contact Us

Friends

  • Webnovels AI
  • Lightnovels AI
  • Datingprofiles AI
  • KQM
  • KQM HSR
  • Kensaku AI - Programmatic SEO

FREE Tools

  • EPUB Split & Merge
  • Light Novel Title Generator
  • Technique Generator
  • Realm Generator
  • Xianxia Profile Generator
  • Plot Generator

Applications

  • Manga Image Translator
  • Webtoon Translator
  • Manhwa Translator
  • EPUB Translation
  • Chinese Novel Translation
  • Japanese Novel Translation

Novel TranslatorNovel Translator

Private AI translation for documents, EPUBs, TXT files, images, and manuscripts you own or have permission to use.

© 2026 • Novel Translator. All rights reserved.

  • Privacy Policy
  • Terms of Service
  • Copyright / DMCA
  • Responsible Use