Novel TranslatorNovel Translator
Pricing
Browse Library

Browse public novel info and discovery pages

Novel Rankings

Top novel lists by genre, language, and more

All Image Translators

Translate images you are allowed to use

Translation Guides

Genre-specific translation tips and vocabulary

Translation Glossary

SFX, honorifics, and comic translation terms

Suki Translate - iOS App

Translate images on your iPhone with our iOS app

EPUB Translation

Translate your EPUB files while keeping formatting

TXT Translation

Translate plain text files and drafts

NSFW Translation

Translate adult content with specialized handling

Chinese Novel Translation

Translate xianxia, wuxia, and cultivation novels

Japanese Novel Translation

Translate light novels, web novels, and isekai

Korean Novel Translation

Translate Korean web novels and manhwa

Traditional Chinese Translation

Translate Traditional Chinese novels

Manga Image Translator

Translate manga pages from Japanese, Korean, Chinese

Webtoon Translator

Translate Korean webtoons instantly

Manhwa Translator

Translate Korean manhwa pages and panels

Comic Image Translator

Translate text in comics and illustrated files

AI Manga Translator

Automatic AI-powered manga translation

Book Translation

Book translation for files you bring

MTL Translation

Clean up rough machine translation drafts

View All Applications

Browse all translation services

Free Ebook ReaderFree

Free desktop reader for manga, EPUB, and TXT novels

EPUB Split & Merge

Split large EPUBs or merge multiple files into one

Light Novel Title Generator

Generate hilariously long light novel titles

Technique Generator

Create unique martial arts and cultivation technique names

Realm Generator

Generate cultivation realm titles for Xianxia stories

Xianxia Profile Generator

Create your own Xianxia Profile Picture and Backstory

Plot Generator

Generate compelling story frameworks and plot summaries

Backstory Generator

Generate rich character backgrounds and motivations

Novel File Cleaner

Clean EPUB/TXT files and validate EPUB structure

Name Generator

Generate culturally appropriate Asian fantasy names

LN Release Calendar

Track upcoming Japanese light novel releases

Reading Time Calculator

Calculate reading time for light novels and web novels

Quote Generator

Create epic quotes and humorous character dialogues

Pinyin Converter

Convert Chinese and Korean text to romanization

Trope Generator

Generate random web novel trope combinations for inspiration

Paragraph Line Splitter

Split text into clean paragraphs with customizable rules

Terminology Database

Searchable database of Wuxia, Xianxia, and Murim terms

CJK Text Formatter

Convert vertical CJK text to horizontal format

Bulk Find & Replace

Search and replace text across EPUB and TXT files

PDF to TXT Converter

Convert PDF documents to plain text format

Manga & Comic Glossary

Sound effects, honorifics, and translation terms explained

Novel TranslatorNovel Translator
  1. Library
  2. I Became a Genius Mechanic at the Academy
I Became a Genius Mechanic at the Academy

I Became a Genius Mechanic at the Academy

WE DO NOT HOST CHAPTERS, DOWNLOADS, SCANS, OR SOURCE FILES FOR THIS TITLE.

This page is for book information only. Upload a file only if you own it, created it, licensed it, or have permission to translate it.

아카데미 메카닉 천재가 되었다.

Original Korean Title

Also known as: 아카데미 메카닉 천재가 되었다.

By 집필하는집사

3.9
Translate your file

Use your own, licensed, public-domain, or permissioned copy.

CompletedkoreanWeb Novel
Language
korean
Type
Web Novel
Status
Completed
Chapters
269 chapters
Original Publisher
novelpia

Genres

Browse Library →
actionadventurecomedyfantasyharemmecharomanceschool lifesci-fishounen
Chapters

269 chapters

Started

2022

Description

「Combination Formula for ‘Plasma Beam Titanium Alloy Gauntlet’」 : Mana Storage Device [Lv.4] : Mana Accelerator [Lv.3] : Purified Gold-Titanium Alloy x 5 : Mana ↔ Energy Conversion Inscription [Lv.1] …I’ve obtained the ultimate blueprint.

Tags

Click any tag to find similar novels in the library

academyartificial intelligencebeastkinbeautiful female leadclever protagonistcunning protagonistdemon lorddemonsdragonsdwarfselvesempiresengineerfirst time interc**rsegenetic modificationsgenius protagonistlove interest falls in love firstmagicmagic beastsmagical technologymale protagonistmysterious pastnoblesobsessive lovepast plays a big rolepast traumaroyaltysmart couplestrong love interestssword and magictragic pasttransmigrationtsundereunique weapon userunique weaponsweak to strongwitchesyandere

Discovery

tsundereyandere

Publication Information

Original Publisher
novelpia
Original Language
korean
Type
Web Novel

I Became a Genius Mechanic at the Academy Review & Spoilers - Novel Translator

My Thoughts on I Became a Genius Mechanic at the Academy

I dove into "I Became a Genius Mechanic at the Academy" with a healthy dose of curiosity, and I've got to say, it's quite the ride. This novel blends fantasy, sci-fi, and academy life into a surprisingly compelling mix, and I found myself enjoying the unique spin it puts on the isekai genre.

First Impressions

The premise immediately grabbed me. A gamer and engineering whiz reincarnated into his favorite game? Sign me up! The initial world-building is swift, and we're quickly introduced to Edgar Fix and his entry into the Imperial Academy. It’s a fast-paced start, and I appreciated that it didn't linger too long on exposition.

What Works Well

Edgar is definitely the highlight. He's not just another overpowered protagonist; his strength lies in his engineering knowledge and unique "Eternal" grade items. Watching him solve problems with a blend of modern science and fantasy elements is genuinely entertaining. I particularly enjoyed the anecdotes of him creating prosthetics and other things using his modern knowledge and the world's resources. The supporting cast is also well-developed, with compelling relationships that add depth to the story. The humor landed well for me, especially the interactions between Edgar and those baffled by his ingenuity. The mix of political intrigue and personal moments kept me engaged, and I rooted for Edgar to not only grow stronger but also build meaningful connections.

Areas of Concern

I did find the character progression felt a little rapid at times, and the romance, while present, seemed somewhat shallow. Also, I feel like the story quickly escalating to the point where the MC is capable of overpowering the whole world is a bit much.

⚠️ Spoiler Warning

Click "Reveal" to show spoiler content

Final Verdict

Despite some minor pacing issues and potential late-game confusion, "I Became a Genius Mechanic at the Academy" is a fun and engaging read. The unique premise, clever protagonist, and blend of genres make it stand out. If you're looking for a web novel with a creative twist on the isekai formula, I'd definitely recommend giving this one a try. I'm rating it a solid 4 out of 5 stars.

Featured On

Top 13 Action NovelsTop 13 Adventure NovelsTop 13 Comedy Novels

Image Translation Guides

Korean to English Manhwa Translator

Translate Korean manhwa and webtoons to English. Handles Hangul OCR, honorific systems, Korean SFX, and vertical scroll webtoon formats. Use images you have permission to work with.

KoreanEnglishmanhwa

Korean to Spanish Manhwa Translator

Translate Korean manhwa and webtoons to Spanish with accurate Hangul OCR, honorific handling, and SFX translation. Use only images you have permission to work with.

KoreanSpanishmanhwa

Korean to Portuguese Manhwa Translator

Translate Korean manhwa to Portuguese with accurate handling of honorifics, SFX, and colloquial dialogue. Use only images you have permission to work with.

KoreanPortuguesemanhwa

Horror Thriller Manhwa Translation Guide

Dive into the chilling world of Horror Thriller manhwa with our comprehensive translation guide. Learn about unique challenges, essential Korean terms,

manhwahorror-thriller

Hunter Gates Manhwa Translation Guide

Dive into the world of Hunter Gates manhwa translation. This guide covers unique challenges, essential Korean genre terms, and practical tips for

manhwahunter-gates

Korean Manhwa Action Sound Effects (SFX) Glossary

Explore 28 essential Korean action sound effects (SFX) commonly found in manhwa and webtoons. This glossary helps readers and translators understand

Koreanaction-sfx

Related Novels

How to Live with a Golden TotemCompleted

How to Live with a Golden Totem

모노카카

3.8
adventuredramafantasy

Description coming soon.

I Became the Academy’s Heroine StalkerCompleted

I Became the Academy’s Heroine Stalker

호곡

3.7
actioncomedyecchi

Description coming soon.

The Nature of Possession

The Nature of Possession

하잘

3.9
actionadventuredrama

Description coming soon.

Make The Namgung Family Great AgainCompleted

Make The Namgung Family Great Again

저택성

4.2
actionadventurefantasy

Description coming soon.

Villain Professor of HeroesCompleted

Villain Professor of Heroes

이야스

3.9
actiondramafantasy

Description coming soon.

I Regressed After Getting Tired of Their ObsessionCompleted

I Regressed After Getting Tired of Their Obsession

대전차지뢰

3.9
actionadultdrama

Description coming soon.

Resources

  • Features
  • Showcases
  • Pricing
  • Pricing Calculator
  • Novel Tools
  • Blog
  • Library
  • Novel Rankings
  • Image Translators
  • Translation Glossary
  • Contact Us

Friends

  • Webnovels AI
  • Lightnovels AI
  • Datingprofiles AI
  • KQM
  • KQM HSR
  • Kensaku AI - Programmatic SEO

FREE Tools

  • EPUB Split & Merge
  • Light Novel Title Generator
  • Technique Generator
  • Realm Generator
  • Xianxia Profile Generator
  • Plot Generator

Applications

  • Manga Image Translator
  • Webtoon Translator
  • Manhwa Translator
  • EPUB Translation
  • Chinese Novel Translation
  • Japanese Novel Translation

Novel TranslatorNovel Translator

Private AI translation for documents, EPUBs, TXT files, images, and manuscripts you own or have permission to use.

© 2026 • Novel Translator. All rights reserved.

  • Privacy Policy
  • Terms of Service
  • Copyright / DMCA
  • Responsible Use